PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 1063aa    MW: 117104 Da    PI: 6.5079
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06934genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.9e-29702752252
    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               ek++sl++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  EMT06934 702 EKHVSLKVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 752
               799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995691772IPR003035RWP-RK domain
PfamPF020422.3E-25705752IPR003035RWP-RK domain
SuperFamilySSF542771.57E-129531012No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-119561011No hitNo description
SMARTSM006660.00159581032IPR000270PB1 domain
PfamPF005643.4E-79591009IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1063 aa     Download sequence    Send to blast
MVGRLGCIGV ATVSSGRGRT RGGVEALGGG PGQGMTSELW VRKISGDDGD RLVLGVHAHF  60
RSYLGIRSRG SSASAPFPPD WILVSSSKNY PRWKCEFYTK EDSVGFLLAI YFPYMLLKVN  120
VSAGIEILCV LVQKDLILGG ERSGMDENGT PDYSDGGSDM DLLMLSGFDD LDSFPELGAG  180
PSFSDGILSS FSVSPAQQVT HISPSQPSVD AEEQGDVSIT DGSDCSVSLA SKEVMNVSAS  240
TVPKTVYGGV TLTERMLRAL AMLKEASTAG PVLVQVWIPV RNGDHQVLTT SDQPFLLDER  300
LTGYREVSRQ FTFSATEGPG LFPGLPGRVF ISGMPEWTSN VMYYNTSEFL RVDYAIRNEV  360
RGSLAMPVFN SSGGSCCAVL EVVMTQEKDN FCSEMDNLSN ALQSVQLSTV RARTHPQSLT  420
RNQQSVLTEI LDVLQGVCHT HMLPLALAWI PVCPNSSLNV SAEYGDQAIK FGLRKKDVLC  480
VQESACYIND MRMHDFLRAC AEHPLEKGQG VAGNAILSNH PFFSSDVREY DMHDYPLAHH  540
ARKFGLHAAV AIRLRSTYTG DDDYVLEFFL PLTCKVREEQ QLLLDDISIT MQRVCSSLRT  600
VSDAELKENT TTMRSEIRCS SSDVSISSCN QIDVSSEVKI NVLLENQIRN SVEQLADKKY  660
AKFEPGTTSQ NFENCSSTGK NVSLTVLQES TSDGLKIRSS TEKHVSLKVL QQYFAGSLKD  720
AAKSIGVCPT TLKRICRQHG ISRWPSRKIK KVNRSLEKIQ NVISTVHGVD GVIKYDPATG  780
CIVSSVSHTE EPPIMNVEHR SSDSLPTECR KFQPDYDAYQ REHLGQAVPH KAQNEKRSET  840
HINLNPGGLS RNSHFGRTSK GSECQDASNG SYLTKEMICP GGMEMWVEGA EQKNVLWNSV  900
SMPQQCKIEI ETDKSNAIVE QSLASSSSMT DCSSGGTSSD GTLKKCLKSR PVDGSNASIV  960
VKAAYKDDTV RLKLLPSMKY QDLLEEIAKR LKLSVGAFQL KYKDDEYEWF QFGVDLHNSY  1020
QDKRITYHTG QDFLVLIAFV ETEVKLRSRG MVMNHIKLKV LSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2492770.0AK249277.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf33g13, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576097.20.0PREDICTED: protein NLP2-like
TrEMBLM8AZZ30.0M8AZZ3_AEGTA; Uncharacterized protein
STRINGMLOC_13610.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein